(data stored in ACNUC7421 zone)

EMBL: CP000821.PE238

CP000821.PE238       Location/Qualifiers
FT   CDS             273869..274867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0238"
FT                   /product="transcriptional regulator-like protein"
FT                   /note="KEGG: saz:Sama_2899 transcriptional regulator-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34851"
FT                   /db_xref="GOA:A8FPS8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPS8"
FT                   /protein_id="ABV34851.1"
FT                   /translation="MRKELSRLDYFTLKVLIGLFEFKSCSVVAEKLNTTQPKVSRALSC
FT                   LREVIQNELFVRQQYGLQPNSMAEKIYPLAKSIVATLEEIDLVAMSEPDTRRVVNVAVQ
FT                   EHMSAFFLEAISEASVHLNQEVVVNVQSWCDNVSQLIAQGKLDYAITVNSTYHEMIENL
FT                   ELGEVRYRFVVAKKGHPIFRKPLSYSGLIENRLVFINYCQVGSKPNWFESSVKLRGEEL
FT                   KLTLKTSSLNMALDHIVKSDDVCCTASIFAYQNFKNRDDTDFFDATDFSHVELAKAKKE
FT                   LAPAEHQKDYYYLQYHHSNEHEFTHLLSEIMKRKLDLMQDEYEQAKSLVAS"
     MRKELSRLDY FTLKVLIGLF EFKSCSVVAE KLNTTQPKVS RALSCLREVI QNELFVRQQY        60
     GLQPNSMAEK IYPLAKSIVA TLEEIDLVAM SEPDTRRVVN VAVQEHMSAF FLEAISEASV       120
     HLNQEVVVNV QSWCDNVSQL IAQGKLDYAI TVNSTYHEMI ENLELGEVRY RFVVAKKGHP       180
     IFRKPLSYSG LIENRLVFIN YCQVGSKPNW FESSVKLRGE ELKLTLKTSS LNMALDHIVK       240
     SDDVCCTASI FAYQNFKNRD DTDFFDATDF SHVELAKAKK ELAPAEHQKD YYYLQYHHSN       300
     EHEFTHLLSE IMKRKLDLMQ DEYEQAKSLV AS                                     332
//

If you have problems or comments...

PBIL Back to PBIL home page