(data stored in ACNUC7421 zone)

EMBL: CP000821.PE240

CP000821.PE240       Location/Qualifiers
FT   CDS             276582..277082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0240"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3155 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34853"
FT                   /db_xref="GOA:A8FPT0"
FT                   /db_xref="InterPro:IPR024402"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPT0"
FT                   /protein_id="ABV34853.1"
FT                   /translation="MNASVIFSYAFMYFVLFLVVPFVLVTFTMTCIKFFKPNDTESVGA
FT                   KIKFSRHPMEPKSVGFINKLNTIVKDKYNVLYGTCLDSILDIDKAETPDDVHSYLRGCH
FT                   LDYVLVDSESSSVKLVITDPEHNSPEQSEFIDNSLAEVGVKVIHLAKNQKWDESLIRNG
FT                   LAA"
     MNASVIFSYA FMYFVLFLVV PFVLVTFTMT CIKFFKPNDT ESVGAKIKFS RHPMEPKSVG        60
     FINKLNTIVK DKYNVLYGTC LDSILDIDKA ETPDDVHSYL RGCHLDYVLV DSESSSVKLV       120
     ITDPEHNSPE QSEFIDNSLA EVGVKVIHLA KNQKWDESLI RNGLAA                      166
//

If you have problems or comments...

PBIL Back to PBIL home page