(data stored in ACNUC7421 zone)

EMBL: CP000821.PE241

CP000821.PE241       Location/Qualifiers
FT   CDS             277170..277643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0241"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: saz:Sama_2902 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34854"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR012286"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPT1"
FT                   /protein_id="ABV34854.1"
FT                   /translation="MSKIDRFVTPLLASILMLVLGSFSPAATAGKVELKINQNKQCIMC
FT                   HKRNGKMFGLHANDALDLTCQNCHGEKAGHPRKASELIGFSAKSVAEPAVQTAACLQCH
FT                   DVETLSQADWTHDVHSNKVNCASCHQLHPEVDPIIGVTALDRSELCSGCHSAK"
     MSKIDRFVTP LLASILMLVL GSFSPAATAG KVELKINQNK QCIMCHKRNG KMFGLHANDA        60
     LDLTCQNCHG EKAGHPRKAS ELIGFSAKSV AEPAVQTAAC LQCHDVETLS QADWTHDVHS       120
     NKVNCASCHQ LHPEVDPIIG VTALDRSELC SGCHSAK                                157
//

If you have problems or comments...

PBIL Back to PBIL home page