(data stored in ACNUC7421 zone)

EMBL: CP000821.PE244

CP000821.PE244       Location/Qualifiers
FT   CDS             279296..279586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0244"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_2184 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34857"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR012286"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPT4"
FT                   /protein_id="ABV34857.1"
FT                   /translation="MFKALGLSILISFSGAVFAGGIADSHAEMSGCESCHEDGAPSDDG
FT                   AFENEACASCHGPLKEFDSDVHNKHEGALLCNDCHVVHEEALAKDSCDNCH"
     MFKALGLSIL ISFSGAVFAG GIADSHAEMS GCESCHEDGA PSDDGAFENE ACASCHGPLK        60
     EFDSDVHNKH EGALLCNDCH VVHEEALAKD SCDNCH                                  96
//

If you have problems or comments...

PBIL Back to PBIL home page