(data stored in ACNUC7421 zone)

EMBL: CP000821.PE247

CP000821.PE247       Location/Qualifiers
FT   CDS             complement(280758..281210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0247"
FT                   /product="protein of unknown function DUF1332"
FT                   /note="KEGG: shn:Shewana3_3955 protein of unknown function
FT                   DUF1332"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34860"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPT7"
FT                   /protein_id="ABV34860.1"
FT                   /translation="MIAKLKKFLSSHSQAVTPEEQARQLNLAAVSLLLEVVFADETLST
FT                   EEAKLLPTLLTSALSLTQAEAEELVDEAKKIQGNSISLYEFTHEINQQCSIEQKQKLIL
FT                   AMWKLAYADGQLCRYENQIIRRTSALLHLKHSELIQMRNLAIESQR"
     MIAKLKKFLS SHSQAVTPEE QARQLNLAAV SLLLEVVFAD ETLSTEEAKL LPTLLTSALS        60
     LTQAEAEELV DEAKKIQGNS ISLYEFTHEI NQQCSIEQKQ KLILAMWKLA YADGQLCRYE       120
     NQIIRRTSAL LHLKHSELIQ MRNLAIESQR                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page