(data stored in ACNUC7421 zone)

EMBL: CP000821.PE248

CP000821.PE248       Location/Qualifiers
FT   CDS             complement(281329..281913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0248"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3594 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34861"
FT                   /db_xref="InterPro:IPR021302"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPT8"
FT                   /protein_id="ABV34861.1"
FT                   /translation="MFLLKKLECSQYSDLFTTGRLTMKLSAVTGLLLGSLMMSSPATAG
FT                   WFDDLTSKKEVKPQVTQTQSSDLVGSVMSQLGLNQSQAEGGLGSLFSLAQSTLGSDDFG
FT                   PIASAIPNMDSLLSAAPAIDSGSGISGLLSQAGDLGASLQGGAQIYDAFEKLGISKELA
FT                   VPMIDIVKGYLDANAGNGTTDLLIKGLGAIL"
     MFLLKKLECS QYSDLFTTGR LTMKLSAVTG LLLGSLMMSS PATAGWFDDL TSKKEVKPQV        60
     TQTQSSDLVG SVMSQLGLNQ SQAEGGLGSL FSLAQSTLGS DDFGPIASAI PNMDSLLSAA       120
     PAIDSGSGIS GLLSQAGDLG ASLQGGAQIY DAFEKLGISK ELAVPMIDIV KGYLDANAGN       180
     GTTDLLIKGL GAIL                                                         194
//

If you have problems or comments...

PBIL Back to PBIL home page