(data stored in ACNUC7421 zone)

EMBL: CP000821.PE249

CP000821.PE249       Location/Qualifiers
FT   CDS             282032..282748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0249"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3593 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34862"
FT                   /db_xref="GOA:A8FPT9"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPT9"
FT                   /protein_id="ABV34862.1"
FT                   /translation="MSLSAIFTEAYNFFRNHISQLAALTVPILFIQVGIQLWLGMEMAN
FT                   ADLENPQFGALHMAAVMALLLVFSLLIASLTLFMEIRSQGHEANTALILKTSLSFVPPL
FT                   LLAGVFSGLAILAPVMLFAAFGPLWLVGLVISIYIFARLAYVNFMVVVERLTPLEAIKG
FT                   SFKFSGAIAFKTLLVLMLYIPLSLIGGTLSSLAQDAVGFPLQLIVEVFIAFIGLFVNVA
FT                   LFRLYMVSRPKVEEQA"
     MSLSAIFTEA YNFFRNHISQ LAALTVPILF IQVGIQLWLG MEMANADLEN PQFGALHMAA        60
     VMALLLVFSL LIASLTLFME IRSQGHEANT ALILKTSLSF VPPLLLAGVF SGLAILAPVM       120
     LFAAFGPLWL VGLVISIYIF ARLAYVNFMV VVERLTPLEA IKGSFKFSGA IAFKTLLVLM       180
     LYIPLSLIGG TLSSLAQDAV GFPLQLIVEV FIAFIGLFVN VALFRLYMVS RPKVEEQA         238
//

If you have problems or comments...

PBIL Back to PBIL home page