(data stored in ACNUC7421 zone)

EMBL: CP000821.PE25

CP000821.PE25        Location/Qualifiers
FT   CDS             31167..31781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0025"
FT                   /product="protein of unknown function UPF0029"
FT                   /note="KEGG: slo:Shew_0021 protein of unknown function
FT                   UPF0029"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34638"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR015269"
FT                   /db_xref="InterPro:IPR015796"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020569"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP65"
FT                   /protein_id="ABV34638.1"
FT                   /translation="MTDSYQVPSAELVIEEEIKHSRFISVLFHCQSYEELKCVLTNVKA
FT                   DYPGASHYCYAFVAAEPQNSIAIGSSDDGEPAGSAGRPMLATLQGANVGEIGAIVVRYF
FT                   GGTKLGVGGLVRAYSSGIKQGLTQLQTELKQIRYPGSLVCEYSQLKDVEYLLNQYDAVV
FT                   EDRSFAEKVTLEFEIPKRYQETLNLGLATMSQGMLSAKFKS"
     MTDSYQVPSA ELVIEEEIKH SRFISVLFHC QSYEELKCVL TNVKADYPGA SHYCYAFVAA        60
     EPQNSIAIGS SDDGEPAGSA GRPMLATLQG ANVGEIGAIV VRYFGGTKLG VGGLVRAYSS       120
     GIKQGLTQLQ TELKQIRYPG SLVCEYSQLK DVEYLLNQYD AVVEDRSFAE KVTLEFEIPK       180
     RYQETLNLGL ATMSQGMLSA KFKS                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page