(data stored in ACNUC7421 zone)

EMBL: CP000821.PE250

CP000821.PE250       Location/Qualifiers
FT   CDS             282807..284225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0250"
FT                   /product="Sel1 domain protein repeat-containing protein"
FT                   /note="KEGG: slo:Shew_3592 Sel1 domain protein
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34863"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR025285"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPU0"
FT                   /protein_id="ABV34863.1"
FT                   /translation="MLTDVEFVTQFSTELGHDYGVAKSYVRDVPTQALLQIRSFTHKLT
FT                   ELLAKPKRITFDSPNLYDRIEMLNRKRVINVRTTRALHKLRGDGNRGAHPEKYHLTSEQ
FT                   LLELSEKSIEKLLSLVASLFTQVTTNPLPEYRFEAFDSFAGRDLCYRAVMESDPQAQYL
FT                   VGMSLKTKALMQREQEQALAEPEEEQGSPPDKFSDSTFKKAEYWFTQAADSNMDALYES
FT                   GVALIHGYSGKVDIAAGEQVIAAAAEANVANAMALLGYFHLVGGESIKLDSDKALHYLQ
FT                   LAADLEQSEAIANLGVLFYQRGDLEKAKHFIAKAAQAGFPHAQYHLALMLARGEGCDAD
FT                   SIAGEQWMAEAAEQGQVDAMLARAQSMLNDDNAFGCDLSQAELYLREAIKYGHSVPAMI
FT                   ELSIALADGMLGKIDVVGSAALLKLARERSNPQELAVIEPLWESLSLQVENVLSMTDNT
FT                   DEVASLQRAKELLS"
     MLTDVEFVTQ FSTELGHDYG VAKSYVRDVP TQALLQIRSF THKLTELLAK PKRITFDSPN        60
     LYDRIEMLNR KRVINVRTTR ALHKLRGDGN RGAHPEKYHL TSEQLLELSE KSIEKLLSLV       120
     ASLFTQVTTN PLPEYRFEAF DSFAGRDLCY RAVMESDPQA QYLVGMSLKT KALMQREQEQ       180
     ALAEPEEEQG SPPDKFSDST FKKAEYWFTQ AADSNMDALY ESGVALIHGY SGKVDIAAGE       240
     QVIAAAAEAN VANAMALLGY FHLVGGESIK LDSDKALHYL QLAADLEQSE AIANLGVLFY       300
     QRGDLEKAKH FIAKAAQAGF PHAQYHLALM LARGEGCDAD SIAGEQWMAE AAEQGQVDAM       360
     LARAQSMLND DNAFGCDLSQ AELYLREAIK YGHSVPAMIE LSIALADGML GKIDVVGSAA       420
     LLKLARERSN PQELAVIEPL WESLSLQVEN VLSMTDNTDE VASLQRAKEL LS               472
//

If you have problems or comments...

PBIL Back to PBIL home page