(data stored in ACNUC7421 zone)

EMBL: CP000821.PE251

CP000821.PE251       Location/Qualifiers
FT   CDS             284323..285573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0251"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3591 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34864"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPU1"
FT                   /protein_id="ABV34864.1"
FT                   /translation="MEIPLPTASQSENERLNELAQSYVKLVLAVGMHDPFYVDAYYGPE
FT                   LWRKECQLVPLSLLDLDAKRLLCELDAVALANADAKLVSRQRFLRTQVASVGYFIRHLQ
FT                   GERGSFDVESMGLYDTQANKFSLESFDSVLTEMAGLLPGEGPLAERFEAFRSGFIVPQN
FT                   RVPQVFEAAVEKARALTGAHISLPESESFSMEFVNDKIWTAYNWYQGNYQSLIQLNQDQ
FT                   PLYIERCLELASHEGYPGHHVFNLLQEQDLVRNEQWIEYAIYPLYSPISFLSEGSANYG
FT                   LRLIMSEDEVLGFERDYLMPLAGIEGDIEHYHRVLTCYKRLAYLDNLVCEQLTDGHICV
FT                   SDAECLLRDYGLYSESRARQRVKFYLSNRAYVINYNHGEESVARWVERGGNTTPVERWR
FT                   RFEALLRRPLSASQFTI"
     MEIPLPTASQ SENERLNELA QSYVKLVLAV GMHDPFYVDA YYGPELWRKE CQLVPLSLLD        60
     LDAKRLLCEL DAVALANADA KLVSRQRFLR TQVASVGYFI RHLQGERGSF DVESMGLYDT       120
     QANKFSLESF DSVLTEMAGL LPGEGPLAER FEAFRSGFIV PQNRVPQVFE AAVEKARALT       180
     GAHISLPESE SFSMEFVNDK IWTAYNWYQG NYQSLIQLNQ DQPLYIERCL ELASHEGYPG       240
     HHVFNLLQEQ DLVRNEQWIE YAIYPLYSPI SFLSEGSANY GLRLIMSEDE VLGFERDYLM       300
     PLAGIEGDIE HYHRVLTCYK RLAYLDNLVC EQLTDGHICV SDAECLLRDY GLYSESRARQ       360
     RVKFYLSNRA YVINYNHGEE SVARWVERGG NTTPVERWRR FEALLRRPLS ASQFTI           416
//

If you have problems or comments...

PBIL Back to PBIL home page