(data stored in ACNUC7421 zone)

EMBL: CP000821.PE252

CP000821.PE252       Location/Qualifiers
FT   CDS             complement(285705..286073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0252"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3590 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34865"
FT                   /db_xref="GOA:A8FPU2"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPU2"
FT                   /protein_id="ABV34865.1"
FT                   /translation="MIYSQFQQSPFQNRFSGVKGWMAFAIGLAVITLTLIALPFVLLIG
FT                   AVSFILLSLFGRIFLKRQLARFRQQQEQGVYGAQQQEADFSQANVERDSQVFTESPFAE
FT                   RRPRVTPHQGRTFEHDPS"
     MIYSQFQQSP FQNRFSGVKG WMAFAIGLAV ITLTLIALPF VLLIGAVSFI LLSLFGRIFL        60
     KRQLARFRQQ QEQGVYGAQQ QEADFSQANV ERDSQVFTES PFAERRPRVT PHQGRTFEHD       120
     PS                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page