(data stored in ACNUC7421 zone)

EMBL: CP000821.PE255

CP000821.PE255       Location/Qualifiers
FT   CDS             complement(288663..289553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0255"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sbl:Sbal_0197 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34868"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPU5"
FT                   /protein_id="ABV34868.1"
FT                   /translation="MNKTTLTLAVLLGLTSTHIYAVQDTAYQHEAEVTYAGSSESFSDG
FT                   TWNGQYRYYFTSVNQDSAPYALSGFLAQTSNLGGQYSKLDVDVDADFTTYAIDGEYVFE
FT                   DKWYIGARYQNADWDNLITKTESDTYTYEVTLGYYFNDTSSVYVNYGKYGNTTQPKYMT
FT                   SLNDISKTEVDTTSYGIGVKSYLPLSSGQGILFSALFSHSSSDAKVISPTDEYQSSDSS
FT                   DSLSAAVDWYITRSWSVGATYATSFDSDWDDPYGINTAYTLRITDGLSAKFNLTKQLEP
FT                   DMDGVFAAIGINGRF"
     MNKTTLTLAV LLGLTSTHIY AVQDTAYQHE AEVTYAGSSE SFSDGTWNGQ YRYYFTSVNQ        60
     DSAPYALSGF LAQTSNLGGQ YSKLDVDVDA DFTTYAIDGE YVFEDKWYIG ARYQNADWDN       120
     LITKTESDTY TYEVTLGYYF NDTSSVYVNY GKYGNTTQPK YMTSLNDISK TEVDTTSYGI       180
     GVKSYLPLSS GQGILFSALF SHSSSDAKVI SPTDEYQSSD SSDSLSAAVD WYITRSWSVG       240
     ATYATSFDSD WDDPYGINTA YTLRITDGLS AKFNLTKQLE PDMDGVFAAI GINGRF           296
//

If you have problems or comments...

PBIL Back to PBIL home page