(data stored in ACNUC7421 zone)

EMBL: CP000821.PE256

CP000821.PE256       Location/Qualifiers
FT   CDS             289774..290367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0256"
FT                   /product="DTW domain containing protein"
FT                   /note="KEGG: shn:Shewana3_3947 DTW domain containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34869"
FT                   /db_xref="InterPro:IPR005636"
FT                   /db_xref="InterPro:IPR039262"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPU6"
FT                   /protein_id="ABV34869.1"
FT                   /translation="MSRPICPKCHYPLKACLCESIESMQVSTELIVLQDPSEVGHAKNS
FT                   VRLLELVIEDTQVYVGECPDDFTQLRQHLEQSVKPVYLVYPSEQSEDVESVSFDEDVIL
FT                   LFLDGTWRKAYKLLQLNPWLQGLPALHLDIESASNYKIRKASRIDSLSTLEAAAMMVKA
FT                   IEPHQEVSPLLNALNAMVNQRISSMPDSVRKRYE"
     MSRPICPKCH YPLKACLCES IESMQVSTEL IVLQDPSEVG HAKNSVRLLE LVIEDTQVYV        60
     GECPDDFTQL RQHLEQSVKP VYLVYPSEQS EDVESVSFDE DVILLFLDGT WRKAYKLLQL       120
     NPWLQGLPAL HLDIESASNY KIRKASRIDS LSTLEAAAMM VKAIEPHQEV SPLLNALNAM       180
     VNQRISSMPD SVRKRYE                                                      197
//

If you have problems or comments...

PBIL Back to PBIL home page