(data stored in ACNUC7421 zone)

EMBL: CP000821.PE26

CP000821.PE26        Location/Qualifiers
FT   CDS             31956..33413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0026"
FT                   /product="potassium uptake protein, TrkH family"
FT                   /note="KEGG: slo:Shew_0022 potassium uptake protein, TrkH
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34639"
FT                   /db_xref="GOA:A8FP66"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP66"
FT                   /protein_id="ABV34639.1"
FT                   /translation="MQYRTIIRITGLLMGLFSLSLLPPALVAVIYKDGGGTAFIQAFAL
FT                   SLFLGFILWYPNRKHHKDLRTREGFLLVVLFWGVLGSIGAVPFIFTAQPDLSMTDSFFE
FT                   SFSALTTTGATVIVGLDSLPKAILFYRHLLQWLGGMGIIVLAVAILPVLGIGGMQLYRA
FT                   EMPGPVKDSKMTPRIAETAKALWYIYFALTIACAFAYWVAGMDLFDAICHSFSTIAIGG
FT                   FSTHDASMGYFDSTAINMVCVVFLLIAALNFSLHFAAFTRRGINLKVYFRDAEFKALII
FT                   VQLVLTGICFATLYHSGIYDSPEETLDFALFQAVSISTTAGFGTESFHVWPLFLPMLLI
FT                   FSSFIGGCGGSTAGGIKVMRMILLLKQGSRELKRLVHPRGMFSIRIGNKALPERVIDAV
FT                   WGFFSAYALVFVICMLALMAMGMDNITAFSATAACLNNLGPGLGEVASNYASISDGAKW
FT                   VLLIAMLFGRLEVFTLLVLFTPTFWRT"
     MQYRTIIRIT GLLMGLFSLS LLPPALVAVI YKDGGGTAFI QAFALSLFLG FILWYPNRKH        60
     HKDLRTREGF LLVVLFWGVL GSIGAVPFIF TAQPDLSMTD SFFESFSALT TTGATVIVGL       120
     DSLPKAILFY RHLLQWLGGM GIIVLAVAIL PVLGIGGMQL YRAEMPGPVK DSKMTPRIAE       180
     TAKALWYIYF ALTIACAFAY WVAGMDLFDA ICHSFSTIAI GGFSTHDASM GYFDSTAINM       240
     VCVVFLLIAA LNFSLHFAAF TRRGINLKVY FRDAEFKALI IVQLVLTGIC FATLYHSGIY       300
     DSPEETLDFA LFQAVSISTT AGFGTESFHV WPLFLPMLLI FSSFIGGCGG STAGGIKVMR       360
     MILLLKQGSR ELKRLVHPRG MFSIRIGNKA LPERVIDAVW GFFSAYALVF VICMLALMAM       420
     GMDNITAFSA TAACLNNLGP GLGEVASNYA SISDGAKWVL LIAMLFGRLE VFTLLVLFTP       480
     TFWRT                                                                   485
//

If you have problems or comments...

PBIL Back to PBIL home page