(data stored in ACNUC7421 zone)

EMBL: CP000821.PE260

CP000821.PE260       Location/Qualifiers
FT   CDS             complement(294163..294876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0260"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3582 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34873"
FT                   /db_xref="GOA:A8FPV0"
FT                   /db_xref="InterPro:IPR009926"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPV0"
FT                   /protein_id="ABV34873.1"
FT                   /translation="MGSSTTYEFSYLNSMPCNTEVTIQVVTPSQPIRLRTRLIGVDPHR
FT                   AIIFALGSDNSWQEAKKFLKPGQPIIVRLVNSDEPDANILAFRSSIRKLLGSTEPWLII
FT                   DYPKALQKVALRQHSRIAINLEASIQVMPAEGSDEGETTQLLSPGQLSNISINGGAFIG
FT                   KILQEISVETPCLLQVKVLQEAETMSIPITIKNIQDIEYGRMRGQYGFELSGEKSETET
FT                   FVQKVILNHLLQQPK"
     MGSSTTYEFS YLNSMPCNTE VTIQVVTPSQ PIRLRTRLIG VDPHRAIIFA LGSDNSWQEA        60
     KKFLKPGQPI IVRLVNSDEP DANILAFRSS IRKLLGSTEP WLIIDYPKAL QKVALRQHSR       120
     IAINLEASIQ VMPAEGSDEG ETTQLLSPGQ LSNISINGGA FIGKILQEIS VETPCLLQVK       180
     VLQEAETMSI PITIKNIQDI EYGRMRGQYG FELSGEKSET ETFVQKVILN HLLQQPK          237
//

If you have problems or comments...

PBIL Back to PBIL home page