(data stored in ACNUC7421 zone)

EMBL: CP000821.PE261

CP000821.PE261       Location/Qualifiers
FT   CDS             295106..296437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0261"
FT                   /product="peptidase M16 domain protein"
FT                   /note="KEGG: slo:Shew_3581 peptidase M16 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34874"
FT                   /db_xref="GOA:A8FPV1"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPV1"
FT                   /protein_id="ABV34874.1"
FT                   /translation="MIRKLSALIMAAGLMMTSQVSQATQVEDIKSFTLDNGMKIMVLED
FT                   ASIPNANMYLFWKVGSRNEVPGITGISHFFEHMMFNGAKKYGPKMFDRTMEAAGGANNA
FT                   YTTENITVYTDWFPANALETIFDLEADRIASLDINEKMVESERGVVASERTTGLENSNW
FT                   RTLQEEIKGAAFRAHPYSWSVIGHESDIAAWTLDDLVQYHKTYYAPNNAVVVIAGDVKL
FT                   AEVKALADKYFAPISAQAPPKEVKTVEPLQKGERRVYVHKASVSTPNVMLAYHVPSTSH
FT                   EDYYALDLLSSVLSTGNSSRLYQSLVEKQVAIEVETYLPMTFDPNLFYVMGVANPGITA
FT                   TELEKDLIAEINKVAREGVTEQELEKVKNIKLMNFYRSMETINGKANTVGTYELYFGSF
FT                   EKLFNAPEAYGKVTPADLQRVAQTYLRRANRTVAVLAAIEETDE"
     MIRKLSALIM AAGLMMTSQV SQATQVEDIK SFTLDNGMKI MVLEDASIPN ANMYLFWKVG        60
     SRNEVPGITG ISHFFEHMMF NGAKKYGPKM FDRTMEAAGG ANNAYTTENI TVYTDWFPAN       120
     ALETIFDLEA DRIASLDINE KMVESERGVV ASERTTGLEN SNWRTLQEEI KGAAFRAHPY       180
     SWSVIGHESD IAAWTLDDLV QYHKTYYAPN NAVVVIAGDV KLAEVKALAD KYFAPISAQA       240
     PPKEVKTVEP LQKGERRVYV HKASVSTPNV MLAYHVPSTS HEDYYALDLL SSVLSTGNSS       300
     RLYQSLVEKQ VAIEVETYLP MTFDPNLFYV MGVANPGITA TELEKDLIAE INKVAREGVT       360
     EQELEKVKNI KLMNFYRSME TINGKANTVG TYELYFGSFE KLFNAPEAYG KVTPADLQRV       420
     AQTYLRRANR TVAVLAAIEE TDE                                               443
//

If you have problems or comments...

PBIL Back to PBIL home page