(data stored in ACNUC7421 zone)

EMBL: CP000821.PE262

CP000821.PE262       Location/Qualifiers
FT   CDS             296434..297876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0262"
FT                   /product="peptidase M16 domain protein"
FT                   /note="KEGG: slo:Shew_3580 peptidase M16 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34875"
FT                   /db_xref="GOA:A8FPV2"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPV2"
FT                   /protein_id="ABV34875.1"
FT                   /translation="MKTLTHLSKSSNRLIAAIFITGMSLSGCATQTVSTPVDTGSFSMP
FT                   AYEQFKLENGLTVYLMPQKEVPLITVNAVVRAGAVNDTTSGVAGMTAQSLLLGADGKSK
FT                   SEIEQMVDFLGASIYADAGKEGSYIGADFMAKDSDKILPLIQSLLLSPDFDAAEFDKLR
FT                   QREIAGLSQAKESPRAVISRYFDKLIYGSHPYGNASSGNSVSLAELNISQLRAFHQSYY
FT                   QPANTAISVVGDFDVKQMKSTMKQLFGRWKNSEEVVTPALKSNQPELTKSQVLLVDKGD
FT                   AIETTFLIGGKGISRDNPDYVGLKVINTILGGRFTSWLNDELRVNAGLTYGARSGFIPY
FT                   SEGGIFRISTFTKTETTKETIDLALKTYARLWETGVDQKTLDSAKAYVKGQFPPKFETS
FT                   GKLAGLLSDMYLYGFDDAFINDFQSKVDGLTLTEAQRLVSTYFPQDNLQFVLIGNADKI
FT                   APIAAEYGDVTRIGIKAVGFGG"
     MKTLTHLSKS SNRLIAAIFI TGMSLSGCAT QTVSTPVDTG SFSMPAYEQF KLENGLTVYL        60
     MPQKEVPLIT VNAVVRAGAV NDTTSGVAGM TAQSLLLGAD GKSKSEIEQM VDFLGASIYA       120
     DAGKEGSYIG ADFMAKDSDK ILPLIQSLLL SPDFDAAEFD KLRQREIAGL SQAKESPRAV       180
     ISRYFDKLIY GSHPYGNASS GNSVSLAELN ISQLRAFHQS YYQPANTAIS VVGDFDVKQM       240
     KSTMKQLFGR WKNSEEVVTP ALKSNQPELT KSQVLLVDKG DAIETTFLIG GKGISRDNPD       300
     YVGLKVINTI LGGRFTSWLN DELRVNAGLT YGARSGFIPY SEGGIFRIST FTKTETTKET       360
     IDLALKTYAR LWETGVDQKT LDSAKAYVKG QFPPKFETSG KLAGLLSDMY LYGFDDAFIN       420
     DFQSKVDGLT LTEAQRLVST YFPQDNLQFV LIGNADKIAP IAAEYGDVTR IGIKAVGFGG       480
//

If you have problems or comments...

PBIL Back to PBIL home page