(data stored in ACNUC7421 zone)

EMBL: CP000821.PE263

CP000821.PE263       Location/Qualifiers
FT   CDS             298019..298585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0263"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: saz:Sama_3442 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34876"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPV3"
FT                   /protein_id="ABV34876.1"
FT                   /translation="MVMSQVLAANKHRDIHQDDDTVDWCHIQESLKILLLAMAQIELSL
FT                   TDGEHNVTELGSLFTNMAKHLDEVNAFLSQQSDTPDEIISHGTDLAASINEGVVAFQFY
FT                   DRVSQRLQHVIMGLALMEEVLNSKQLRISPDAWRKLQEEIQESYSLDCERKMFDLVLQG
FT                   TSVHEALKLYRDENQSPKEDDIELF"
     MVMSQVLAAN KHRDIHQDDD TVDWCHIQES LKILLLAMAQ IELSLTDGEH NVTELGSLFT        60
     NMAKHLDEVN AFLSQQSDTP DEIISHGTDL AASINEGVVA FQFYDRVSQR LQHVIMGLAL       120
     MEEVLNSKQL RISPDAWRKL QEEIQESYSL DCERKMFDLV LQGTSVHEAL KLYRDENQSP       180
     KEDDIELF                                                                188
//

If you have problems or comments...

PBIL Back to PBIL home page