(data stored in ACNUC7421 zone)

EMBL: CP000821.PE264

CP000821.PE264       Location/Qualifiers
FT   CDS             298542..299078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0264"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: she:Shewmr4_3739 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34877"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPV4"
FT                   /protein_id="ABV34877.1"
FT                   /translation="MKISHLKKMISSCFKYSLLFLIFTPSLSLADKASFSDFCLSMAGQ
FT                   WQGTSAKLKQKPLQTYVSAICSADRRQLIFSVSRSAKHPFSETWWFRERGESTFLIYYD
FT                   GVDKDKSQSFSLYQQNESFSLLGEGKLNKRPALIQLRFEPKESGWLWLQNVQYLDDDTD
FT                   RYLFYRGIEMMPLER"
     MKISHLKKMI SSCFKYSLLF LIFTPSLSLA DKASFSDFCL SMAGQWQGTS AKLKQKPLQT        60
     YVSAICSADR RQLIFSVSRS AKHPFSETWW FRERGESTFL IYYDGVDKDK SQSFSLYQQN       120
     ESFSLLGEGK LNKRPALIQL RFEPKESGWL WLQNVQYLDD DTDRYLFYRG IEMMPLER         178
//

If you have problems or comments...

PBIL Back to PBIL home page