(data stored in ACNUC7421 zone)

EMBL: CP000821.PE267

CP000821.PE267       Location/Qualifiers
FT   CDS             complement(300775..301671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0267"
FT                   /product="conserved hypothetical pyruvate formate lyase
FT                   activating enzyme"
FT                   /note="KEGG: ppr:PBPRA2007 hypothetical pyruvate formate
FT                   lyase activating enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34880"
FT                   /db_xref="GOA:A8FPV7"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012839"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR023912"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPV7"
FT                   /protein_id="ABV34880.1"
FT                   /translation="MNNRLSTLSKTASVSQIINFSCVDGPGSRLVVFLQGCNYNCKNCH
FT                   NPHTIDMCDSCGDCIAHCPTQALSMESIDGKDAIRWNSDLCSGCDTCLAVCPKQSTPKT
FT                   QEYNVTQMLEMIRKQASFISGITISGGEATLQLHFIIALFKAIKSSDDLQHLSCMLDSN
FT                   GSLNETAWQKLLPYMDGAMIDLKAWQQETHRYITGRDNHRVLRSINLLNLHNKLYEVRL
FT                   LQIPEVTDFESEIDALAGFLTQLPPSTRIKLNAFQHHGVTGEALAWRVCSEANIERLAS
FT                   QLTERGVKQPILPSVYL"
     MNNRLSTLSK TASVSQIINF SCVDGPGSRL VVFLQGCNYN CKNCHNPHTI DMCDSCGDCI        60
     AHCPTQALSM ESIDGKDAIR WNSDLCSGCD TCLAVCPKQS TPKTQEYNVT QMLEMIRKQA       120
     SFISGITISG GEATLQLHFI IALFKAIKSS DDLQHLSCML DSNGSLNETA WQKLLPYMDG       180
     AMIDLKAWQQ ETHRYITGRD NHRVLRSINL LNLHNKLYEV RLLQIPEVTD FESEIDALAG       240
     FLTQLPPSTR IKLNAFQHHG VTGEALAWRV CSEANIERLA SQLTERGVKQ PILPSVYL         298
//

If you have problems or comments...

PBIL Back to PBIL home page