(data stored in ACNUC7421 zone)

EMBL: CP000821.PE268

CP000821.PE268       Location/Qualifiers
FT   CDS             complement(301643..303196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0268"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO2407 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34881"
FT                   /db_xref="InterPro:IPR016905"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPV8"
FT                   /protein_id="ABV34881.1"
FT                   /translation="MTLQKKFAQIVSDPRLSPKQKSNYLALEADASLPYLTISKAVTQA
FT                   MSTGIICDMFEGNAPFKPRYVLPDYAKFLQQGSEYLELQAPQDLDEALNALTIIYHHVP
FT                   SVTNIPVYLGQLDEILMPFVDGLDEDVVYRKLKLFWIMLDRTLPDAFMHVNIGPSDNIV
FT                   CRTILRVDAELKQVAPNLTFMYDPDITPDALLQVAASNICECSKPHIANYPIHKSAYDK
FT                   QGFGIVSCYNSLPLAGGANTLVRLNLKEVALKADNIDNFFAHTLPHYCQLTYELIEARS
FT                   KYLHEESHFFDSFLVKEALIEEQRFAPMFGIYGMAEAVNILLGNPELCETASEKPSKHY
FT                   GHSKAANELGHRISAALDSIVKSTPVTYGYHGRALLHSQGGISLDIDVTPGVRIPYGTE
FT                   PDPISHVRALAEHHQYYTSGISDILTIDETVKSNPEAMYQLCKGTLSLGFREFTANVAS
FT                   NDLIRVTGYMIKLSDIADFKRQGSRTNTTGLGAEAAANTGILNRKPRVTSHEQSPVYAK
FT                   "
     MTLQKKFAQI VSDPRLSPKQ KSNYLALEAD ASLPYLTISK AVTQAMSTGI ICDMFEGNAP        60
     FKPRYVLPDY AKFLQQGSEY LELQAPQDLD EALNALTIIY HHVPSVTNIP VYLGQLDEIL       120
     MPFVDGLDED VVYRKLKLFW IMLDRTLPDA FMHVNIGPSD NIVCRTILRV DAELKQVAPN       180
     LTFMYDPDIT PDALLQVAAS NICECSKPHI ANYPIHKSAY DKQGFGIVSC YNSLPLAGGA       240
     NTLVRLNLKE VALKADNIDN FFAHTLPHYC QLTYELIEAR SKYLHEESHF FDSFLVKEAL       300
     IEEQRFAPMF GIYGMAEAVN ILLGNPELCE TASEKPSKHY GHSKAANELG HRISAALDSI       360
     VKSTPVTYGY HGRALLHSQG GISLDIDVTP GVRIPYGTEP DPISHVRALA EHHQYYTSGI       420
     SDILTIDETV KSNPEAMYQL CKGTLSLGFR EFTANVASND LIRVTGYMIK LSDIADFKRQ       480
     GSRTNTTGLG AEAAANTGIL NRKPRVTSHE QSPVYAK                                517
//

If you have problems or comments...

PBIL Back to PBIL home page