(data stored in ACNUC7421 zone)

EMBL: CP000821.PE271

CP000821.PE271       Location/Qualifiers
FT   CDS             307242..308222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0271"
FT                   /product="alcohol dehydrogenase GroES domain protein"
FT                   /note="KEGG: slo:Shew_3572 alcohol dehydrogenase GroES
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34884"
FT                   /db_xref="GOA:A8FPW1"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014188"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPW1"
FT                   /protein_id="ABV34884.1"
FT                   /translation="MFKALVLTQEDRVTLANICQLPETDLPEGEVLVDVACSSLNYKDG
FT                   LAVTGTGRIIRNFPMVPGIDFAGVVSESADPRYKAGDRVILTGWGVGENHWGGMAEKAR
FT                   VNADWLVPMPEACSADKAMMIGTAGLTAMLCVQALQNANIKPESGDILVTGASGGVGSV
FT                   AVTLLSRLGYKVVASTGRADENADLLRSLGASEVMERSELEQDARPLEKQRWAGIVDTV
FT                   GNKVLATALAQMQYGGAAAICGLAGGFALPTTVMPFILRGVSLLGVDSVSCPFEKRQAA
FT                   WEQVLELLPDSYYQQAGQTISLDQVPEFADKIVKGQVTGRVLVKL"
     MFKALVLTQE DRVTLANICQ LPETDLPEGE VLVDVACSSL NYKDGLAVTG TGRIIRNFPM        60
     VPGIDFAGVV SESADPRYKA GDRVILTGWG VGENHWGGMA EKARVNADWL VPMPEACSAD       120
     KAMMIGTAGL TAMLCVQALQ NANIKPESGD ILVTGASGGV GSVAVTLLSR LGYKVVASTG       180
     RADENADLLR SLGASEVMER SELEQDARPL EKQRWAGIVD TVGNKVLATA LAQMQYGGAA       240
     AICGLAGGFA LPTTVMPFIL RGVSLLGVDS VSCPFEKRQA AWEQVLELLP DSYYQQAGQT       300
     ISLDQVPEFA DKIVKGQVTG RVLVKL                                            326
//

If you have problems or comments...

PBIL Back to PBIL home page