(data stored in ACNUC7421 zone)

EMBL: CP000821.PE276

CP000821.PE276       Location/Qualifiers
FT   CDS             complement(312872..313735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0276"
FT                   /product="transcriptional regulator, LysR family protein"
FT                   /note="KEGG: sfr:Sfri_3892 transcriptional regulator, LysR
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34889"
FT                   /db_xref="GOA:A8FPW6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPW6"
FT                   /protein_id="ABV34889.1"
FT                   /translation="MLKSELLEGFIAVAECGNLSKAAEKICRTQSTLSLQIKKLEESVG
FT                   QSLLLRDNKGVTLTEPGETLLNYAYKMMQLNSQALDELKECKNKEVIRLGVPTDYINRY
FT                   LSSSLLEFIREFTCIELVIDTDVSGNLYKRLHQGEFDVIVATHWQTPAPGHGELLFERR
FT                   FLWATAKGGNAHKRNTIPMALYPENCPIRAQVFANHQISMRQINVLLSTPSPNALCMAV
FT                   ENDLAIAPIAEFRINDKMEVLDPIEHNLPPLPVFNESLYLNPDTQTKATKQLTTLLKAH
FT                   TEKYQQ"
     MLKSELLEGF IAVAECGNLS KAAEKICRTQ STLSLQIKKL EESVGQSLLL RDNKGVTLTE        60
     PGETLLNYAY KMMQLNSQAL DELKECKNKE VIRLGVPTDY INRYLSSSLL EFIREFTCIE       120
     LVIDTDVSGN LYKRLHQGEF DVIVATHWQT PAPGHGELLF ERRFLWATAK GGNAHKRNTI       180
     PMALYPENCP IRAQVFANHQ ISMRQINVLL STPSPNALCM AVENDLAIAP IAEFRINDKM       240
     EVLDPIEHNL PPLPVFNESL YLNPDTQTKA TKQLTTLLKA HTEKYQQ                     287
//

If you have problems or comments...

PBIL Back to PBIL home page