(data stored in ACNUC7421 zone)

EMBL: CP000821.PE278

CP000821.PE278       Location/Qualifiers
FT   CDS             complement(314510..315877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0278"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: sbl:Sbal_0260 integral membrane sensor signal
FT                   transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34891"
FT                   /db_xref="GOA:A8FPW8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPW8"
FT                   /protein_id="ABV34891.1"
FT                   /translation="MIKDRLPNRIFIKLLLGFWLCSSLIIAIVGLLPLLQQSHDRAPLP
FT                   PHLEKLLERYAERIIDNPEIIQNNQFRRLSHRRDFQGKPIRFYLVNDQGRVINTEKVSR
FT                   GMRRFMLMAEETSKPISHQFKDELLFGPYNFAVSGKQYSLYGRFNDRHPRPWFFFFAEN
FT                   KLLTLTLAIGLSGLICGLLAWHLGKPLRTLRLSADALANGDLTNRVDYATTKRKDEIGQ
FT                   LAQAFNGMADSVENMVNSQQRLISDISHELRTPLTRLQLALALARKKGQESAETERIGY
FT                   EAEQLEKMISELLELSKVKLNAHDHKRHLGLAETLGQVLDDAEFEAEQQQKELIIKIDE
FT                   EIELPLYPKPLSRAIENLLRNAIRYSQSSVSIKAHKAMNIVTIEITDDGPGIDNEQDLL
FT                   AIFKPFYRPQSARERESGGWGLGLAITEAAVMAHQGKITASNLAPHGLNVTIELPS"
     MIKDRLPNRI FIKLLLGFWL CSSLIIAIVG LLPLLQQSHD RAPLPPHLEK LLERYAERII        60
     DNPEIIQNNQ FRRLSHRRDF QGKPIRFYLV NDQGRVINTE KVSRGMRRFM LMAEETSKPI       120
     SHQFKDELLF GPYNFAVSGK QYSLYGRFND RHPRPWFFFF AENKLLTLTL AIGLSGLICG       180
     LLAWHLGKPL RTLRLSADAL ANGDLTNRVD YATTKRKDEI GQLAQAFNGM ADSVENMVNS       240
     QQRLISDISH ELRTPLTRLQ LALALARKKG QESAETERIG YEAEQLEKMI SELLELSKVK       300
     LNAHDHKRHL GLAETLGQVL DDAEFEAEQQ QKELIIKIDE EIELPLYPKP LSRAIENLLR       360
     NAIRYSQSSV SIKAHKAMNI VTIEITDDGP GIDNEQDLLA IFKPFYRPQS ARERESGGWG       420
     LGLAITEAAV MAHQGKITAS NLAPHGLNVT IELPS                                  455
//

If you have problems or comments...

PBIL Back to PBIL home page