(data stored in ACNUC7421 zone)

EMBL: CP000821.PE28

CP000821.PE28        Location/Qualifiers
FT   CDS             complement(34180..34488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0028"
FT                   /product="regulatory protein, ArsR"
FT                   /note="KEGG: shw:Sputw3181_0018 regulatory protein, ArsR"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34641"
FT                   /db_xref="GOA:A8FP68"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP68"
FT                   /protein_id="ABV34641.1"
FT                   /translation="MQKEIDVDAMVTNAESAAKWLKAIANPYRLMILCLLLENEYSVTE
FT                   LNETVPLSQSALSQHLAVLRAQDLVSTRKSSQVVYYKLKNEQVTKIISILHSQYCAN"
     MQKEIDVDAM VTNAESAAKW LKAIANPYRL MILCLLLENE YSVTELNETV PLSQSALSQH        60
     LAVLRAQDLV STRKSSQVVY YKLKNEQVTK IISILHSQYC AN                          102
//

If you have problems or comments...

PBIL Back to PBIL home page