(data stored in ACNUC7421 zone)

EMBL: CP000821.PE280

CP000821.PE280       Location/Qualifiers
FT   CDS             316789..317295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0280"
FT                   /product="protein of unknown function, Spy-related"
FT                   /note="KEGG: she:Shewmr4_0253 protein of unknown function,
FT                   Spy-related"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34893"
FT                   /db_xref="GOA:A8FPX0"
FT                   /db_xref="InterPro:IPR012899"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPX0"
FT                   /protein_id="ABV34893.1"
FT                   /translation="MKANTLKAGLLAIVAGTALLTTSVYAEQQTGCQDSGYHMKGDRMG
FT                   HHNGGMKSAMKKMFRGLDLTDEQRTEIKTLMKAQKDSMQGSRPTSDERQAHKTEMLALI
FT                   TADSFDESQVKLLMQQKHEKRQDKAVGMLKVQNEIYKLLTPEQQVKFKENFEKGHSRHE
FT                   RKGER"
     MKANTLKAGL LAIVAGTALL TTSVYAEQQT GCQDSGYHMK GDRMGHHNGG MKSAMKKMFR        60
     GLDLTDEQRT EIKTLMKAQK DSMQGSRPTS DERQAHKTEM LALITADSFD ESQVKLLMQQ       120
     KHEKRQDKAV GMLKVQNEIY KLLTPEQQVK FKENFEKGHS RHERKGER                    168
//

If you have problems or comments...

PBIL Back to PBIL home page