(data stored in ACNUC7421 zone)

EMBL: CP000821.PE283

CP000821.PE283       Location/Qualifiers
FT   CDS             complement(333272..334312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0283"
FT                   /product="signal transduction histidine kinase, nitrogen
FT                   specific, NtrB"
FT                   /note="KEGG: shw:Sputw3181_0222 signal transduction
FT                   histidine kinase, nitrogen specific, NtrB"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34896"
FT                   /db_xref="GOA:A8FPX3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPX3"
FT                   /protein_id="ABV34896.1"
FT                   /translation="MDIKHLFNNLVTAVMVIDVDLKLCYANAAAEQLLGVGSHRLTEHV
FT                   LSDSFQILGVSTDLLSKAIRENQGLTVNTAPLVTLDNQHHTVDITLTPLEQEQGLGLLE
FT                   LRQVDQQRRIHQQLTLDAQQQAAQYLVRNLAHEIKNPLGGLRGAAQLLSRELHDPQLNE
FT                   FTDLIIEQADRLRNLVDRLLGPQRPTQHSLHNIHEVVQKVLNLVNMALPPNITLKQDYD
FT                   PSIPDIQMDPEQLQQAVLNIVQNAIQALDTAGGEILIRTRTQHQVTIGTLRHKLVLALS
FT                   IIDNGPGIKPELLDTLFYPMVTGRDNGSGLGLSIAHNFARLHGGRIDCHSKLGRTEFTI
FT                   LLPIKN"
     MDIKHLFNNL VTAVMVIDVD LKLCYANAAA EQLLGVGSHR LTEHVLSDSF QILGVSTDLL        60
     SKAIRENQGL TVNTAPLVTL DNQHHTVDIT LTPLEQEQGL GLLELRQVDQ QRRIHQQLTL       120
     DAQQQAAQYL VRNLAHEIKN PLGGLRGAAQ LLSRELHDPQ LNEFTDLIIE QADRLRNLVD       180
     RLLGPQRPTQ HSLHNIHEVV QKVLNLVNMA LPPNITLKQD YDPSIPDIQM DPEQLQQAVL       240
     NIVQNAIQAL DTAGGEILIR TRTQHQVTIG TLRHKLVLAL SIIDNGPGIK PELLDTLFYP       300
     MVTGRDNGSG LGLSIAHNFA RLHGGRIDCH SKLGRTEFTI LLPIKN                      346
//

If you have problems or comments...

PBIL Back to PBIL home page