(data stored in ACNUC7421 zone)

EMBL: CP000821.PE284

CP000821.PE284       Location/Qualifiers
FT   CDS             complement(334444..334980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0284"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3559 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34897"
FT                   /db_xref="InterPro:IPR025392"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPX4"
FT                   /protein_id="ABV34897.1"
FT                   /translation="MRLALIFSLLLFTVISHAAVYKWVDKDGKIHYSDKPIQNSEVVEF
FT                   KSNTQNQITIQAPKNSASDTEEQTVPSTQYKMSILTPKEDETIRDNNGDITIMATITPD
FT                   LKPKHLLVILMDDKVIGPAQENPIFSLKNIDRGEHSFVIKAVAQNGKQLATTSPRKIFL
FT                   HRAIINSKAKVTPFN"
     MRLALIFSLL LFTVISHAAV YKWVDKDGKI HYSDKPIQNS EVVEFKSNTQ NQITIQAPKN        60
     SASDTEEQTV PSTQYKMSIL TPKEDETIRD NNGDITIMAT ITPDLKPKHL LVILMDDKVI       120
     GPAQENPIFS LKNIDRGEHS FVIKAVAQNG KQLATTSPRK IFLHRAIINS KAKVTPFN         178
//

If you have problems or comments...

PBIL Back to PBIL home page