(data stored in ACNUC7421 zone)

EMBL: CP000821.PE285

CP000821.PE285       Location/Qualifiers
FT   CDS             complement(335181..335858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0285"
FT                   /product="ThiJ/PfpI domain protein"
FT                   /note="KEGG: sbl:Sbal_0270 ThiJ/PfpI domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34898"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPX5"
FT                   /protein_id="ABV34898.1"
FT                   /translation="MNILMVLTSHDKLGDTGLKTGFWLEEFASPYYRFKDKNFNITLAS
FT                   PAGGQPPLDPTSEQADFQTAATDRFNQDSETQQQLATTLTLASIKAEDYDAIFYPGGHG
FT                   PLWDLTNDAHSIALIQAFYQANKPVGLVCHAPGALKNVKSADGTPLVQGKRVTGFTNTE
FT                   EAAVQLTDVVPFLVEEMMQENGALYSKGDDWASYLAVDGNLVTGQNPASSEVVADEMIK
FT                   QLG"
     MNILMVLTSH DKLGDTGLKT GFWLEEFASP YYRFKDKNFN ITLASPAGGQ PPLDPTSEQA        60
     DFQTAATDRF NQDSETQQQL ATTLTLASIK AEDYDAIFYP GGHGPLWDLT NDAHSIALIQ       120
     AFYQANKPVG LVCHAPGALK NVKSADGTPL VQGKRVTGFT NTEEAAVQLT DVVPFLVEEM       180
     MQENGALYSK GDDWASYLAV DGNLVTGQNP ASSEVVADEM IKQLG                       225
//

If you have problems or comments...

PBIL Back to PBIL home page