(data stored in ACNUC7421 zone)

EMBL: CP000821.PE288

CP000821.PE288       Location/Qualifiers
FT   CDS             complement(337975..338292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0288"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34901"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPX8"
FT                   /protein_id="ABV34901.1"
FT                   /translation="MNNKIKATLVSLSLLFTSTSYAAMSDIAVCNDCSAQEVKTLIDNE
FT                   TSANIYVVDFVNRTAQKFTSGDENGSQPIAIAMSISELNTINQRYEYRKTHLRALNPSS
FT                   K"
     MNNKIKATLV SLSLLFTSTS YAAMSDIAVC NDCSAQEVKT LIDNETSANI YVVDFVNRTA        60
     QKFTSGDENG SQPIAIAMSI SELNTINQRY EYRKTHLRAL NPSSK                       105
//

If you have problems or comments...

PBIL Back to PBIL home page