(data stored in ACNUC7421 zone)

EMBL: CP000821.PE290

CP000821.PE290       Location/Qualifiers
FT   CDS             complement(339691..342486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0290"
FT                   /product="Histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="KEGG: saz:Sama_0067 signal transduction histidine
FT                   kinase-like protein protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34903"
FT                   /db_xref="GOA:A8FPY0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPY0"
FT                   /protein_id="ABV34903.1"
FT                   /translation="MAPSSYRHSIGFRLNLSTLIIGFIICVILSGYFIQETRERLKVQA
FT                   HHELTQITDSLKLALETNSQTSNMIRVVGVLSTYPNITRLTVIKASDLSISADSLVQNN
FT                   GKRANLVFSNTIMKLINNPAKSSQRDQGILIDNSLHQSVKIHLVDPQANRLKPYIIYLE
FT                   YNKQALERILQQARNHLMLIVIGGLILLLLINIFIQRVVVLKPLSKMTQQLLNQDNSEQ
FT                   IPEPLQVSTNDEFSILANSYNGSIHKQLLQKAEVEKSHRYIKNMASALPVHLLYVDIDK
FT                   KIQFINQYSLQWLAKPMEEVLTQTCRQVLPSQLFSLIERPIETALQGDSITLDAEFFHK
FT                   NMSLFFHITHIPDIDNEGRIKGIFICIEDRTQTRDNEKKIEKYAHQLEMNNLALDDARE
FT                   TAEAAAQSKSEFLACMSHEIRTPMNGVLGMLTLLERTALDQSQRNHLDTAQGSARNLLG
FT                   LINDILDFSKIESGKFPIESVNFSLTNLLNETIRPLAIRAQEKGIELVSDITDITSQSF
FT                   KGDPTRISQVLTNLIGNAIKFTEKGSITVYVKQNDDIEPRLNFSVEDTGIGLASNQLEK
FT                   LFQPFTQADSSTTRHFGGTGLGLSIAKRLTELMGGSISVVSTEGKGSKFSFNVRVEIAS
FT                   KDDLYATDLNSLPILFFSRGTRADQVLGKTLNLLNASLKVVKAARLANFKPASISDTYR
FT                   PKLTIIHLPAGQEAIETELAKLASNTDLPDTPILLFIAAIDESIMTQYLNEQIFTYLCN
FT                   PLHLEQLLIALKQIDQTAPHLVQRLAPQTQRDWDLKSYFEDRLPKLLLVEDNKTNQMVA
FT                   QGIIAEFGLEIDIASDGEQAIEILKDSITSPYQLIFMDCQMPRLDGYQTTQMIRAGYTG
FT                   HQYKHIPIIAMTANAMVGDRERCLQAGMNDYISKPLDPDDIKQALLSTLAGHDTESEMR
FT                   N"
     MAPSSYRHSI GFRLNLSTLI IGFIICVILS GYFIQETRER LKVQAHHELT QITDSLKLAL        60
     ETNSQTSNMI RVVGVLSTYP NITRLTVIKA SDLSISADSL VQNNGKRANL VFSNTIMKLI       120
     NNPAKSSQRD QGILIDNSLH QSVKIHLVDP QANRLKPYII YLEYNKQALE RILQQARNHL       180
     MLIVIGGLIL LLLINIFIQR VVVLKPLSKM TQQLLNQDNS EQIPEPLQVS TNDEFSILAN       240
     SYNGSIHKQL LQKAEVEKSH RYIKNMASAL PVHLLYVDID KKIQFINQYS LQWLAKPMEE       300
     VLTQTCRQVL PSQLFSLIER PIETALQGDS ITLDAEFFHK NMSLFFHITH IPDIDNEGRI       360
     KGIFICIEDR TQTRDNEKKI EKYAHQLEMN NLALDDARET AEAAAQSKSE FLACMSHEIR       420
     TPMNGVLGML TLLERTALDQ SQRNHLDTAQ GSARNLLGLI NDILDFSKIE SGKFPIESVN       480
     FSLTNLLNET IRPLAIRAQE KGIELVSDIT DITSQSFKGD PTRISQVLTN LIGNAIKFTE       540
     KGSITVYVKQ NDDIEPRLNF SVEDTGIGLA SNQLEKLFQP FTQADSSTTR HFGGTGLGLS       600
     IAKRLTELMG GSISVVSTEG KGSKFSFNVR VEIASKDDLY ATDLNSLPIL FFSRGTRADQ       660
     VLGKTLNLLN ASLKVVKAAR LANFKPASIS DTYRPKLTII HLPAGQEAIE TELAKLASNT       720
     DLPDTPILLF IAAIDESIMT QYLNEQIFTY LCNPLHLEQL LIALKQIDQT APHLVQRLAP       780
     QTQRDWDLKS YFEDRLPKLL LVEDNKTNQM VAQGIIAEFG LEIDIASDGE QAIEILKDSI       840
     TSPYQLIFMD CQMPRLDGYQ TTQMIRAGYT GHQYKHIPII AMTANAMVGD RERCLQAGMN       900
     DYISKPLDPD DIKQALLSTL AGHDTESEMR N                                      931
//

If you have problems or comments...

PBIL Back to PBIL home page