(data stored in ACNUC7421 zone)

EMBL: CP000821.PE291

CP000821.PE291       Location/Qualifiers
FT   CDS             complement(342492..343454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0291"
FT                   /product="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   system protein"
FT                   /note="KEGG: slo:Shew_3789 ABC-type
FT                   nitrate/sulfonate/bicarbonate transport system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34904"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPY1"
FT                   /protein_id="ABV34904.1"
FT                   /translation="MTMIKYLASLLITLMLTACGGEKPQPQITIAINPWPGYELLYLAE
FT                   KKGFFEKVGINIKLVQTATLSDAQRAYINGRVDGFTSTIVEAVQAQEFGGEPLTIALLA
FT                   DYSNGGDVILGSESFQSITDLKGKKVGCEVSSLGIYILARALAVSDMSLDDVQIVNMEQ
FT                   GNAHQALAYGQIDAMVTYPPYSFDILNDKKLASHRIFTTAEIPNEILDTVSLSKGVIAR
FT                   NPKLTSQLQQAWQLAMDYLEQHPEEAVKHMAEREQISEIEFNQALSDIHLLSSMEQKQL
FT                   LKDKEKLTKLSKSVCNTLNQVGAFNSSCLHVESLFHSGI"
     MTMIKYLASL LITLMLTACG GEKPQPQITI AINPWPGYEL LYLAEKKGFF EKVGINIKLV        60
     QTATLSDAQR AYINGRVDGF TSTIVEAVQA QEFGGEPLTI ALLADYSNGG DVILGSESFQ       120
     SITDLKGKKV GCEVSSLGIY ILARALAVSD MSLDDVQIVN MEQGNAHQAL AYGQIDAMVT       180
     YPPYSFDILN DKKLASHRIF TTAEIPNEIL DTVSLSKGVI ARNPKLTSQL QQAWQLAMDY       240
     LEQHPEEAVK HMAEREQISE IEFNQALSDI HLLSSMEQKQ LLKDKEKLTK LSKSVCNTLN       300
     QVGAFNSSCL HVESLFHSGI                                                   320
//

If you have problems or comments...

PBIL Back to PBIL home page