(data stored in ACNUC7421 zone)

EMBL: CP000821.PE293

CP000821.PE293       Location/Qualifiers
FT   CDS             345432..347255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0293"
FT                   /product="GTP-binding protein TypA"
FT                   /note="KEGG: slo:Shew_3553 GTP-binding protein TypA"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34906"
FT                   /db_xref="GOA:A8FPY3"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPY3"
FT                   /protein_id="ABV34906.1"
FT                   /translation="MLENLRNIAIIAHVDHGKTTLVDKMLAQSGTLETRGEATERVMDS
FT                   NDLEKERGITILAKNTAIKWNDYRINIVDTPGHADFGGEVERVLSMVDSVLLLVDAVDG
FT                   PMPQTRFVTKKAFAQGLKPIVVINKIDRPGARPDWVIDQVFDLFDNLGATDEQLDFPIV
FT                   YASALNGFASLDPEVSEGDMTPLFETIVEKVSSPDADAEGDFQMQISQIDYNSYVGVIG
FT                   IGRIKRGSVKTNQQVTIIGADGKKRNGKMGQVLGYMGLDRNEVAEANAGDIVAITGLGQ
FT                   LQISDTVCAPTTVEALPPLSVDEPTLTMTFQVNTSPFAGKEGKYVTSRNILERLEQELV
FT                   HNVALRVEETDSPDRFRVSGRGELHLSILIENMRREGYELAVSRPEVIVKEIDGEMCEP
FT                   FETLTVDVEEDHQGTVIEKLGIRKGDMRDMQLDGKGRVRIDFVIPSRGLIGFQTEFMTA
FT                   TSGTGLIYHSFDHYGPVKGGDIGQRARGVLISNATGKALTFALFNLQERGRLFITHAAE
FT                   VYEGQVVGLHARANDLTVNCLKGKQLTNMRASGTDEAQVLTPHIEMTLEQALEFIDDDE
FT                   LVEVTPLNIRVRKRYLTENERKRHNRAAKDA"
     MLENLRNIAI IAHVDHGKTT LVDKMLAQSG TLETRGEATE RVMDSNDLEK ERGITILAKN        60
     TAIKWNDYRI NIVDTPGHAD FGGEVERVLS MVDSVLLLVD AVDGPMPQTR FVTKKAFAQG       120
     LKPIVVINKI DRPGARPDWV IDQVFDLFDN LGATDEQLDF PIVYASALNG FASLDPEVSE       180
     GDMTPLFETI VEKVSSPDAD AEGDFQMQIS QIDYNSYVGV IGIGRIKRGS VKTNQQVTII       240
     GADGKKRNGK MGQVLGYMGL DRNEVAEANA GDIVAITGLG QLQISDTVCA PTTVEALPPL       300
     SVDEPTLTMT FQVNTSPFAG KEGKYVTSRN ILERLEQELV HNVALRVEET DSPDRFRVSG       360
     RGELHLSILI ENMRREGYEL AVSRPEVIVK EIDGEMCEPF ETLTVDVEED HQGTVIEKLG       420
     IRKGDMRDMQ LDGKGRVRID FVIPSRGLIG FQTEFMTATS GTGLIYHSFD HYGPVKGGDI       480
     GQRARGVLIS NATGKALTFA LFNLQERGRL FITHAAEVYE GQVVGLHARA NDLTVNCLKG       540
     KQLTNMRASG TDEAQVLTPH IEMTLEQALE FIDDDELVEV TPLNIRVRKR YLTENERKRH       600
     NRAAKDA                                                                 607
//

If you have problems or comments...

PBIL Back to PBIL home page