(data stored in ACNUC7421 zone)

EMBL: CP000821.PE294

CP000821.PE294       Location/Qualifiers
FT   CDS             complement(347570..348784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0294"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="KEGG: slo:Shew_3549 4Fe-4S ferredoxin, iron-sulfur
FT                   binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34907"
FT                   /db_xref="GOA:A8FPY4"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPY4"
FT                   /protein_id="ABV34907.1"
FT                   /translation="MSFVESLTLMLALAYSASLLYWSGKKSGAVVTIIIAVGAGISSLY
FT                   WPLLVALAIAATSLTIFTKLRPEAAKGELRANSLRDGIQHLLALSMLLVGVQFAANTAM
FT                   LKAGITPWLARPDVGDAFLPIAGGIELKAIMTLGLWDQTHPAAAVMLAVVLLTGLLCKR
FT                   AFCGWACPLGLAGEYLYKLRKRFIKQEFMPPAWLDWPLRMLKYLLLAALLYIIIGMPSA
FT                   SIPQYLAGNYHKIADLKMALFFVTPGLITLICFAFILGLSAWRRQGFCRYICPYGALLG
FT                   IISFLSPFKIRRSTQHCLIETKGMNCDKCTRACPANISVHTQKNIRSDECQACMRCVSA
FT                   CPKREALHFSTRNGIKLSARGLTIMLLLIMFIIPLGAYVGDFWHSQTLDQDRIYLIQHL
FT                   KSIGH"
     MSFVESLTLM LALAYSASLL YWSGKKSGAV VTIIIAVGAG ISSLYWPLLV ALAIAATSLT        60
     IFTKLRPEAA KGELRANSLR DGIQHLLALS MLLVGVQFAA NTAMLKAGIT PWLARPDVGD       120
     AFLPIAGGIE LKAIMTLGLW DQTHPAAAVM LAVVLLTGLL CKRAFCGWAC PLGLAGEYLY       180
     KLRKRFIKQE FMPPAWLDWP LRMLKYLLLA ALLYIIIGMP SASIPQYLAG NYHKIADLKM       240
     ALFFVTPGLI TLICFAFILG LSAWRRQGFC RYICPYGALL GIISFLSPFK IRRSTQHCLI       300
     ETKGMNCDKC TRACPANISV HTQKNIRSDE CQACMRCVSA CPKREALHFS TRNGIKLSAR       360
     GLTIMLLLIM FIIPLGAYVG DFWHSQTLDQ DRIYLIQHLK SIGH                        404
//

If you have problems or comments...

PBIL Back to PBIL home page