(data stored in ACNUC7421 zone)

EMBL: CP000821.PE295

CP000821.PE295       Location/Qualifiers
FT   CDS             complement(349069..349839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0295"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sat:SYN_00385 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34908"
FT                   /db_xref="InterPro:IPR025737"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPY5"
FT                   /protein_id="ABV34908.1"
FT                   /translation="MYNTWYNADALTNDNGDDTGLDVDINAYVQVHRLVHVTEKKLFGA
FT                   NWAYNVIVPMINKETSIADFGVDDSTSFALGDVVLEPLALFWFRDNYEAALGLSVIVPT
FT                   GDYDPADAASPGMGYWSGMLTLGGTYYLDSDKSWSVSGLTRTLVHSEQDDTDIRPGAEF
FT                   IIEGGIGKQFALDEHWLLRPGLSYCASWQISDDSRDGHGTLAGERKTGYGIGGEVNVFY
FT                   LPWLLQGNLRYVNEFGTKNTAKGSSFVFTLTKSF"
     MYNTWYNADA LTNDNGDDTG LDVDINAYVQ VHRLVHVTEK KLFGANWAYN VIVPMINKET        60
     SIADFGVDDS TSFALGDVVL EPLALFWFRD NYEAALGLSV IVPTGDYDPA DAASPGMGYW       120
     SGMLTLGGTY YLDSDKSWSV SGLTRTLVHS EQDDTDIRPG AEFIIEGGIG KQFALDEHWL       180
     LRPGLSYCAS WQISDDSRDG HGTLAGERKT GYGIGGEVNV FYLPWLLQGN LRYVNEFGTK       240
     NTAKGSSFVF TLTKSF                                                       256
//

If you have problems or comments...

PBIL Back to PBIL home page