(data stored in ACNUC7421 zone)

EMBL: CP000821.PE296

CP000821.PE296       Location/Qualifiers
FT   CDS             complement(350171..351406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0296"
FT                   /product="Arabinose efflux permease-like protein"
FT                   /note="KEGG: mem:Memar_0422 major facilitator superfamily
FT                   MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34909"
FT                   /db_xref="GOA:A8FPY6"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPY6"
FT                   /protein_id="ABV34909.1"
FT                   /translation="MRPDHRNFYRVTRMAHRNHFQLLFVINFIVTLGFGICDTFFSVYV
FT                   FELGGRGALLALPLISYSVAKAVFSPFMGRCSDTFGPEKIMLVSLTIYLLVSVLFLVST
FT                   NLFILAISRLLQGVACAMFRPVIVSLVSESAIKEKRSSIMGTFDISFYAALSFGPIVGG
FT                   YMKDQLGFSAIFSGVTLLCILAILLCTCCVRDSSARVATTHSSRNKPSSLIQPIIRSRN
FT                   LRGLLAFIFGRASCISLTGTFLPIILTEELKLTGTQIGIVMASSCLTITLLLRPMGMLA
FT                   DRVSHAILIILGGISVSIIYLIIPATLTFTQIIFATTLLGLFSALSQPACTAMLVEEGT
FT                   HYGTGNTVGIFNGAMNLGFIFGPIFGAFILSGFGIDAVFYSAGVIGASTILLFALITHP
FT                   SLLSPVDSRCKN"
     MRPDHRNFYR VTRMAHRNHF QLLFVINFIV TLGFGICDTF FSVYVFELGG RGALLALPLI        60
     SYSVAKAVFS PFMGRCSDTF GPEKIMLVSL TIYLLVSVLF LVSTNLFILA ISRLLQGVAC       120
     AMFRPVIVSL VSESAIKEKR SSIMGTFDIS FYAALSFGPI VGGYMKDQLG FSAIFSGVTL       180
     LCILAILLCT CCVRDSSARV ATTHSSRNKP SSLIQPIIRS RNLRGLLAFI FGRASCISLT       240
     GTFLPIILTE ELKLTGTQIG IVMASSCLTI TLLLRPMGML ADRVSHAILI ILGGISVSII       300
     YLIIPATLTF TQIIFATTLL GLFSALSQPA CTAMLVEEGT HYGTGNTVGI FNGAMNLGFI       360
     FGPIFGAFIL SGFGIDAVFY SAGVIGASTI LLFALITHPS LLSPVDSRCK N                411
//

If you have problems or comments...

PBIL Back to PBIL home page