(data stored in ACNUC7421 zone)

EMBL: CP000821.PE298

CP000821.PE298       Location/Qualifiers
FT   CDS             complement(351912..353438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0298"
FT                   /product="putative flavoprotein subunit of a reductase"
FT                   /note="KEGG: eca:ECA0910 putative flavoprotein subunit of a
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34911"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPY8"
FT                   /protein_id="ABV34911.1"
FT                   /translation="MNKLSMAIALSLLSASSYAANYTKNVDVVVIGSGASGMAAAAAAE
FT                   EKGLTTVLLEKQANIGGSALYIEGTFAVETEQQKSMYIGLTKDWAYKNHMEFNHGFING
FT                   PLMRKWINRSDESIKWMEEKGVTFHDVRTLFEDGNRTWHIFKDGKGVEFVQKMEQSFTK
FT                   NGGKIYTETPATELVYKDGKVVGVIAEDGEGDTYTFNAKGGVIVATGGFINNPKMLKKF
FT                   GIRTDHLIVGPKKGRDGDSIKWWEETGARLEGMKTHLAIGAWLYGKDPNTQLSHPEHTT
FT                   VYSQMASLLRQPYMWVAKDGKRFIDESQAPLWHNTGPAVERVGNGYFAVFDDNMREYMK
FT                   TDGIDISHSDWVRVGHKLDLLDEGIEVGQKEGWLVKSNTIEGLAKKMGIDVATFKQTVV
FT                   DANRYAINGVDEEFPKNRKYVRSMDKPPYFAVKGQNATLITLGGPTTDTDMQVLREKDM
FT                   KPVGGLYVVGCEVGGVYGDSYNLTLEGMASSFAINSGRFAAEHIAQKMKL"
     MNKLSMAIAL SLLSASSYAA NYTKNVDVVV IGSGASGMAA AAAAEEKGLT TVLLEKQANI        60
     GGSALYIEGT FAVETEQQKS MYIGLTKDWA YKNHMEFNHG FINGPLMRKW INRSDESIKW       120
     MEEKGVTFHD VRTLFEDGNR TWHIFKDGKG VEFVQKMEQS FTKNGGKIYT ETPATELVYK       180
     DGKVVGVIAE DGEGDTYTFN AKGGVIVATG GFINNPKMLK KFGIRTDHLI VGPKKGRDGD       240
     SIKWWEETGA RLEGMKTHLA IGAWLYGKDP NTQLSHPEHT TVYSQMASLL RQPYMWVAKD       300
     GKRFIDESQA PLWHNTGPAV ERVGNGYFAV FDDNMREYMK TDGIDISHSD WVRVGHKLDL       360
     LDEGIEVGQK EGWLVKSNTI EGLAKKMGID VATFKQTVVD ANRYAINGVD EEFPKNRKYV       420
     RSMDKPPYFA VKGQNATLIT LGGPTTDTDM QVLREKDMKP VGGLYVVGCE VGGVYGDSYN       480
     LTLEGMASSF AINSGRFAAE HIAQKMKL                                          508
//

If you have problems or comments...

PBIL Back to PBIL home page