(data stored in ACNUC7421 zone)

EMBL: CP000821.PE3

CP000821.PE3         Location/Qualifiers
FT   CDS             complement(3635..3892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0003"
FT                   /product="protein of unknown function DUF37"
FT                   /note="KEGG: slo:Shew_3867 protein of unknown function
FT                   DUF37"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34616"
FT                   /db_xref="GOA:A8FP43"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FP43"
FT                   /protein_id="ABV34616.1"
FT                   /translation="MAKTQSPLQWLATTLIRGYQVFISPFLGANKCRFHPTCSTYAIEA
FT                   IRLHGFAKGSWLAARRILKCHPLHPGGIDPVPPKKHRCNK"
     MAKTQSPLQW LATTLIRGYQ VFISPFLGAN KCRFHPTCST YAIEAIRLHG FAKGSWLAAR        60
     RILKCHPLHP GGIDPVPPKK HRCNK                                              85
//

If you have problems or comments...

PBIL Back to PBIL home page