(data stored in ACNUC7421 zone)

EMBL: CP000821.PE30

CP000821.PE30        Location/Qualifiers
FT   CDS             35726..36166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34643"
FT                   /db_xref="GOA:A8FP70"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP70"
FT                   /protein_id="ABV34643.1"
FT                   /translation="MNFSFPNKMSIFTRVFQLILCITLIFILAKLFFEAGVLGVNPILK
FT                   NIVFISSCLAIGWIFKIKYYWNYQQDHQDHLSVILGINLFGFSFVKIFDNGILVMKHRG
FT                   FWKKQLNLDVNSSLTVTVRLDQSQSPSFGCLAVKNSKQLVST"
     MNFSFPNKMS IFTRVFQLIL CITLIFILAK LFFEAGVLGV NPILKNIVFI SSCLAIGWIF        60
     KIKYYWNYQQ DHQDHLSVIL GINLFGFSFV KIFDNGILVM KHRGFWKKQL NLDVNSSLTV       120
     TVRLDQSQSP SFGCLAVKNS KQLVST                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page