(data stored in ACNUC7421 zone)

EMBL: CP000821.PE300

CP000821.PE300       Location/Qualifiers
FT   CDS             complement(355662..356309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0300"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sbl:Sbal_0313 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34913"
FT                   /db_xref="InterPro:IPR021342"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPZ0"
FT                   /protein_id="ABV34913.1"
FT                   /translation="MKKYISIAIIATSLLLTGCQSAYYGAMEKVGYHKRDIMVDRVEDA
FT                   KESQEDAQKQFSSALEEMQALLNHDGGDLEGAYNKAKDEYESAQDAADDVTKRIDKVED
FT                   VAEALFDEWQSEIGEISKASLRRNSEAKLRETKRSYNQLVKSMRRAESKMPPVLTAMKD
FT                   NMLYLKHNLNAQAIGAIKGEFTSLQTDISGLIKEMNKSIDESNKFIASLEGN"
     MKKYISIAII ATSLLLTGCQ SAYYGAMEKV GYHKRDIMVD RVEDAKESQE DAQKQFSSAL        60
     EEMQALLNHD GGDLEGAYNK AKDEYESAQD AADDVTKRID KVEDVAEALF DEWQSEIGEI       120
     SKASLRRNSE AKLRETKRSY NQLVKSMRRA ESKMPPVLTA MKDNMLYLKH NLNAQAIGAI       180
     KGEFTSLQTD ISGLIKEMNK SIDESNKFIA SLEGN                                  215
//

If you have problems or comments...

PBIL Back to PBIL home page