(data stored in ACNUC7421 zone)

EMBL: CP000821.PE301

CP000821.PE301       Location/Qualifiers
FT   CDS             complement(356351..356578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0301"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3546 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34914"
FT                   /db_xref="GOA:A8FPZ1"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPZ1"
FT                   /protein_id="ABV34914.1"
FT                   /translation="MSQQGSAGNVIAAIASFFFAGLGQLVQGRILAAIIFCLATYASYG
FT                   IATFTFGIFLVVALPLHLWCIIDAARYKAD"
     MSQQGSAGNV IAAIASFFFA GLGQLVQGRI LAAIIFCLAT YASYGIATFT FGIFLVVALP        60
     LHLWCIIDAA RYKAD                                                         75
//

If you have problems or comments...

PBIL Back to PBIL home page