(data stored in ACNUC7421 zone)

EMBL: CP000821.PE304

CP000821.PE304       Location/Qualifiers
FT   CDS             358574..359143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0304"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sbl:Sbal_0317 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34917"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPZ4"
FT                   /protein_id="ABV34917.1"
FT                   /translation="MKKLIIAGLVTMLSACAATDKSDTTASATIAPERVTLGGMTNEDA
FT                   AKTLFDALIKKNYLATMASPSRIALQFDDNQFVLQPSINPDGIDRIMMNRFYAVHPKLV
FT                   GSQDLLILIGTLNHKLNFAKFTLRENGAIIQVQGAATFVNTIELEEIRRFMLWTDEGLR
FT                   QVGHSLPKGSEQLIKPIPVMQQSRSL"
     MKKLIIAGLV TMLSACAATD KSDTTASATI APERVTLGGM TNEDAAKTLF DALIKKNYLA        60
     TMASPSRIAL QFDDNQFVLQ PSINPDGIDR IMMNRFYAVH PKLVGSQDLL ILIGTLNHKL       120
     NFAKFTLREN GAIIQVQGAA TFVNTIELEE IRRFMLWTDE GLRQVGHSLP KGSEQLIKPI       180
     PVMQQSRSL                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page