(data stored in ACNUC7421 zone)

EMBL: CP000821.PE306

CP000821.PE306       Location/Qualifiers
FT   CDS             359652..360125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0306"
FT                   /product="thioesterase domain, putative"
FT                   /note="KEGG: slo:Shew_3541 thioesterase domain, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34919"
FT                   /db_xref="InterPro:IPR012660"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPZ6"
FT                   /protein_id="ABV34919.1"
FT                   /translation="MTASDERGQQIASLLKELTETWHQTIPVSEFMQISPLGYHDNRLK
FT                   VTAPLSPNINLHQTMFAGSIYTLATLTGWGMLWLQQRLAEVNGDIVLADGHIRYLAPIS
FT                   GAPTAKVSWPDVDLSRLTLGRRVKVKLVVEIYVGDRCCAEFEGIYVSQPVPHT"
     MTASDERGQQ IASLLKELTE TWHQTIPVSE FMQISPLGYH DNRLKVTAPL SPNINLHQTM        60
     FAGSIYTLAT LTGWGMLWLQ QRLAEVNGDI VLADGHIRYL APISGAPTAK VSWPDVDLSR       120
     LTLGRRVKVK LVVEIYVGDR CCAEFEGIYV SQPVPHT                                157
//

If you have problems or comments...

PBIL Back to PBIL home page