(data stored in ACNUC7421 zone)

EMBL: CP000821.PE307

CP000821.PE307       Location/Qualifiers
FT   CDS             360318..360911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0307"
FT                   /product="(acyl-carrier-protein) phosphodiesterase"
FT                   /note="KEGG: slo:Shew_3529 (acyl-carrier-protein)
FT                   phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34920"
FT                   /db_xref="GOA:A8FPZ7"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR023048"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FPZ7"
FT                   /protein_id="ABV34920.1"
FT                   /translation="MSKVLILKSSILGDYSQSGQLVEHLKQHWEQQGAEISVRDLAAEP
FT                   LPMLDGEIASGLRGGDQLSARQEQALLLSDSLIQELKAHDTIVIAAPMYNFSIPTQLKN
FT                   WIDLVARAGVSFTYTETGPKGLITGKRAVLITTRGGVHKGGASDHVVPYLKTVLGFIGI
FT                   EEVETVYSEALNMGPEASKQGIESAQQALEKIVA"
     MSKVLILKSS ILGDYSQSGQ LVEHLKQHWE QQGAEISVRD LAAEPLPMLD GEIASGLRGG        60
     DQLSARQEQA LLLSDSLIQE LKAHDTIVIA APMYNFSIPT QLKNWIDLVA RAGVSFTYTE       120
     TGPKGLITGK RAVLITTRGG VHKGGASDHV VPYLKTVLGF IGIEEVETVY SEALNMGPEA       180
     SKQGIESAQQ ALEKIVA                                                      197
//

If you have problems or comments...

PBIL Back to PBIL home page