(data stored in ACNUC7421 zone)

EMBL: CP000821.PE308

CP000821.PE308       Location/Qualifiers
FT   CDS             complement(361077..361397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0308"
FT                   /product="rhodanese domain protein"
FT                   /note="KEGG: sbl:Sbal_0322 rhodanese domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34921"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPZ8"
FT                   /protein_id="ABV34921.1"
FT                   /translation="MLQSLLSKLAGAGPDKRSWELIKQGARVIDVRTPEEFGSGHLPQA
FT                   INVPLSQISTWLIDQDPKQSFVLYCAAGIRAQKACDQLKCSGFPNVINAGSLKDLLSYQ
FT                   AT"
     MLQSLLSKLA GAGPDKRSWE LIKQGARVID VRTPEEFGSG HLPQAINVPL SQISTWLIDQ        60
     DPKQSFVLYC AAGIRAQKAC DQLKCSGFPN VINAGSLKDL LSYQAT                      106
//

If you have problems or comments...

PBIL Back to PBIL home page