(data stored in ACNUC7421 zone)

EMBL: CP000821.PE309

CP000821.PE309       Location/Qualifiers
FT   CDS             complement(361522..362268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0309"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_0284 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34922"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPZ9"
FT                   /protein_id="ABV34922.1"
FT                   /translation="MIKHITLALVLTLSSVAGQALAETFTEAEYVAIFNGDNINKQKQA
FT                   IDSLVLAGLSDPKVFDTLHAKFKASLPQAVNNASIDYSAWLLKGLAYSGDEKYLQTFNE
FT                   IIAGDYPGKLKKYAKKSIPTLKQYKSWTPILSDKSQYAASETREVNVIANALRSDELEL
FT                   KRYAAKRMINHSLYAPYLLSVLDSELKDPRLLKHEKLAINTYAYMAKALASSGEPEYKA
FT                   TLEHIAKQSSERKLQKYAKKYLKTYY"
     MIKHITLALV LTLSSVAGQA LAETFTEAEY VAIFNGDNIN KQKQAIDSLV LAGLSDPKVF        60
     DTLHAKFKAS LPQAVNNASI DYSAWLLKGL AYSGDEKYLQ TFNEIIAGDY PGKLKKYAKK       120
     SIPTLKQYKS WTPILSDKSQ YAASETREVN VIANALRSDE LELKRYAAKR MINHSLYAPY       180
     LLSVLDSELK DPRLLKHEKL AINTYAYMAK ALASSGEPEY KATLEHIAKQ SSERKLQKYA       240
     KKYLKTYY                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page