(data stored in ACNUC7421 zone)

EMBL: CP000821.PE31

CP000821.PE31        Location/Qualifiers
FT   CDS             complement(36602..38044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0031"
FT                   /product="potassium uptake protein, TrkH family"
FT                   /note="KEGG: slo:Shew_3740 potassium uptake protein, TrkH
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34644"
FT                   /db_xref="GOA:A8FP71"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP71"
FT                   /protein_id="ABV34644.1"
FT                   /translation="MLNLRPLLFILGIFLSTLTVFMFVPLFFALFYGEETVGAFMIASL
FT                   LTGTCASACMHQGRGHQLHLNIRDMFLLTSLTWLIVSFFAAMPFTLYHGINYTDAFFET
FT                   MSGITTTGSTVLSGLDKMDHSILIWRSLLQWMGGIGFIVMAVAVLPFLNVGGMRLFRTE
FT                   SSDWSDKAIPRTQDMAKHLFYIYIFLTICCGLAYHWAGMSWFEAINHSMTTLSTGGYST
FT                   SDSSMAAFSNQAHWVGTLFMAAGGLPLLIFVNCIQHRSLWVWNDAQVKGFLLFLSTVSI
FT                   GLAFWLWLGHEMTPIDALRLASFNVVSVVTTTGYGLTDYTAWGALANVAFLFLMFVGSC
FT                   SGSTSGGIKIFRFQIAIAIMREQLKQQFHPNGVFKERYNNRVISEDIVRSLVTFVLLFM
FT                   LVIVVLSIILVMTGLDPTTSFTGAVTAVTNVGPGLGHTIGPAGNFSTLPDVAKWALAIG
FT                   MLLGRLEILTVAVLFHPGFWKY"
     MLNLRPLLFI LGIFLSTLTV FMFVPLFFAL FYGEETVGAF MIASLLTGTC ASACMHQGRG        60
     HQLHLNIRDM FLLTSLTWLI VSFFAAMPFT LYHGINYTDA FFETMSGITT TGSTVLSGLD       120
     KMDHSILIWR SLLQWMGGIG FIVMAVAVLP FLNVGGMRLF RTESSDWSDK AIPRTQDMAK       180
     HLFYIYIFLT ICCGLAYHWA GMSWFEAINH SMTTLSTGGY STSDSSMAAF SNQAHWVGTL       240
     FMAAGGLPLL IFVNCIQHRS LWVWNDAQVK GFLLFLSTVS IGLAFWLWLG HEMTPIDALR       300
     LASFNVVSVV TTTGYGLTDY TAWGALANVA FLFLMFVGSC SGSTSGGIKI FRFQIAIAIM       360
     REQLKQQFHP NGVFKERYNN RVISEDIVRS LVTFVLLFML VIVVLSIILV MTGLDPTTSF       420
     TGAVTAVTNV GPGLGHTIGP AGNFSTLPDV AKWALAIGML LGRLEILTVA VLFHPGFWKY       480
//

If you have problems or comments...

PBIL Back to PBIL home page