(data stored in ACNUC7421 zone)

EMBL: CP000821.PE311

CP000821.PE311       Location/Qualifiers
FT   CDS             complement(363567..364292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0311"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) reductase,
FT                   putative"
FT                   /note="KEGG: sfr:Sfri_0338 3-oxoacyl-(acyl-carrier-protein)
FT                   reductase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34924"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011285"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ01"
FT                   /protein_id="ABV34924.1"
FT                   /translation="MNKRILITGSSRGIGKAIALQLAEAGYDIALHFHSNREAAELTKQ
FT                   ALLEHGVNVSSLQFDIADREGVKTSIESDIEQHGAYYGVVLNAGINCDTAFPAMTEDEW
FT                   DSVVHTNLDGFYNVIHPTIMPMIQTRLGGRIITMASVSGIAGNRGQVNYSASKAGIIGA
FT                   TKALSLELAKRKITVNCIAPGLIETDMVADIPKDMVKEIVPMRRMGKPSEIAGLAKFLM
FT                   SEDAAYITRQVISVNGGMI"
     MNKRILITGS SRGIGKAIAL QLAEAGYDIA LHFHSNREAA ELTKQALLEH GVNVSSLQFD        60
     IADREGVKTS IESDIEQHGA YYGVVLNAGI NCDTAFPAMT EDEWDSVVHT NLDGFYNVIH       120
     PTIMPMIQTR LGGRIITMAS VSGIAGNRGQ VNYSASKAGI IGATKALSLE LAKRKITVNC       180
     IAPGLIETDM VADIPKDMVK EIVPMRRMGK PSEIAGLAKF LMSEDAAYIT RQVISVNGGM       240
     I                                                                       241
//

If you have problems or comments...

PBIL Back to PBIL home page