(data stored in ACNUC7421 zone)

EMBL: CP000821.PE312

CP000821.PE312       Location/Qualifiers
FT   CDS             complement(364299..364787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0312"
FT                   /product="beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase, FabA/FabZ"
FT                   /note="KEGG: slo:Shew_3524
FT                   beta-hydroxyacyl-(acyl-carrier-protein) dehydratase,
FT                   FabA/FabZ"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34925"
FT                   /db_xref="InterPro:IPR016776"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ02"
FT                   /protein_id="ABV34925.1"
FT                   /translation="MTQEYLLPEPLSQLPVAEVVPHRDPMILIDTLVEHGPDTLLTQTN
FT                   ITKQSPYFDAAIDAVPNYVGIEYMAQSIAALAGLEAKSRGEAIRVGFLLGSRKLKMHRP
FT                   NYTLGESYQTRVTRLYQEESGLAVFDCQVFHGDTLVAEANVNVFQPQDALAYISESQG"
     MTQEYLLPEP LSQLPVAEVV PHRDPMILID TLVEHGPDTL LTQTNITKQS PYFDAAIDAV        60
     PNYVGIEYMA QSIAALAGLE AKSRGEAIRV GFLLGSRKLK MHRPNYTLGE SYQTRVTRLY       120
     QEESGLAVFD CQVFHGDTLV AEANVNVFQP QDALAYISES QG                          162
//

If you have problems or comments...

PBIL Back to PBIL home page