(data stored in ACNUC7421 zone)

EMBL: CP000821.PE314

CP000821.PE314       Location/Qualifiers
FT   CDS             complement(366060..366692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0314"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3522 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34927"
FT                   /db_xref="InterPro:IPR021675"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ04"
FT                   /protein_id="ABV34927.1"
FT                   /translation="MVQFHNTIPDRLKRGKGICVLICLTMLVSACSQTLQRQTCVALAK
FT                   GVSYCLAPIPSDNKARSATQQVAINVNDSRHELLSHLELDREKLTLVGLAPLGQALFTL
FT                   VFDGASLNSQQSMLLGDEFKAEYLLALIQLIYWPLEDVNAHLQGATLTSPECDAPRCRR
FT                   IYATGNDTKADQQESILKIRFDKREPWKAEVELAIPQANFELKITPV"
     MVQFHNTIPD RLKRGKGICV LICLTMLVSA CSQTLQRQTC VALAKGVSYC LAPIPSDNKA        60
     RSATQQVAIN VNDSRHELLS HLELDREKLT LVGLAPLGQA LFTLVFDGAS LNSQQSMLLG       120
     DEFKAEYLLA LIQLIYWPLE DVNAHLQGAT LTSPECDAPR CRRIYATGND TKADQQESIL       180
     KIRFDKREPW KAEVELAIPQ ANFELKITPV                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page